SLAMF7 Peptide - middle region
SLAMF7 Peptide - middle region
Product Specifications
Product Name Alternative
19A, CS1, CD319, CRACC
UniProt
Q9NQ25
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLAMF7 Rabbit Polyclonal Antibody (orb588867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269517.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10422196 96 Well
Human Protein regulator of cytokinesis 1 ELISA kit
Sign In for Pricing
View Details 
PC1012091-01 250 mg
1- (3,5-Dichloro-4-methoxyphenyl) -2,2,2-trifluoroethanone
Sign In for Pricing
View Details PC1012091-02 500 mg
1- (3,5-Dichloro-4-methoxyphenyl) -2,2,2-trifluoroethanone
Sign In for Pricing
View Details PC1012091-03 1 g
1- (3,5-Dichloro-4-methoxyphenyl) -2,2,2-trifluoroethanone
Sign In for Pricing
View Details