Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPRPN Peptide - N-terminal region

OPRPN Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPLP, PRL1, PROL1, opiorphin

UniProt

P21730

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPRPN Rabbit Polyclonal Antibody (orb588868) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR44 (NM_001184966) Human Tagged Lenti ORF Clone
RC230520L4 10 µg

WDR44 (NM_001184966) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Progesterone antibody
STJ400164 1 mg

Anti-Progesterone antibody

Sign In for Pricing
View Details
CCDC93 Mouse Monoclonal Antibody [Clone:6E11]
E45M14675 100 µg

CCDC93 Mouse Monoclonal Antibody [Clone:6E11]

Sign In for Pricing
View Details
POLD4 (NM_021173) Human Over-expression Lysate
LS057804-100ug 100 µg

POLD4 (NM_021173) Human Over-expression Lysate

Sign In for Pricing
View Details
RHAG Protein Lysate (Human) with C-Ha Tag
39492031 100 µg

RHAG Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
ATAD3C Antibody, Biotin conjugated
CSB-PA716349LD01HU-01 50 µg

ATAD3C Antibody, Biotin conjugated

Sign In for Pricing
View Details