Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN1A1 Peptide - middle region

BTN1A1 Peptide - middle region

Product Specifications

Product Name Alternative

BT, BTN, BTN1

UniProt

Q13410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTN1A1 Rabbit Polyclonal Antibody (orb588225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001723.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISM1 Protein Lysate
OCOA06772-20UG 20 µg

ISM1 Protein Lysate

Sign In for Pricing
View Details
Dapagliflozin-3-O-beta-D-Glucuronide
MBS5796940 Inquire

Dapagliflozin-3-O-beta-D-Glucuronide

Sign In for Pricing
View Details
PSAT1 Antibody, HRP conjugated
MBS7107048-01 0.05 mg

PSAT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
PSAT1 Antibody, HRP conjugated
MBS7107048-02 0.1 mg

PSAT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
PSAT1 Antibody, HRP conjugated
MBS7107048-03 5x 0.1 mg

PSAT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 (strain EC4115/EHEC) solA Polyclonal Antibody
MBS7172036 Inquire

Rabbit anti-Escherichia coli O157:H7 (strain EC4115/EHEC) solA Polyclonal Antibody

Sign In for Pricing
View Details