Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN1A1 Peptide - middle region

BTN1A1 Peptide - middle region

Product Specifications

Product Name Alternative

BT, BTN, BTN1

UniProt

Q13410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTN1A1 Rabbit Polyclonal Antibody (orb588225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001723.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) RSXD Polyclonal Antibody
MBS7189174 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) RSXD Polyclonal Antibody

Sign In for Pricing
View Details
Bradford Protein Quantification Kit
E111-02 1000 Reactions

Bradford Protein Quantification Kit

Sign In for Pricing
View Details
Anti-DGK-Alpha (A340) DGKA Antibody
A06354-1 100 µL

Anti-DGK-Alpha (A340) DGKA Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8593R) - Azide and BSA Free
NBP3-24155 100 µg

Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/8593R) - Azide and BSA Free

Sign In for Pricing
View Details
Human Caldesmon (CALD) ELISA Kit
RD-CALD-Hu-48Tests 48 Tests

Human Caldesmon (CALD) ELISA Kit

Sign In for Pricing
View Details
Anti-RSBN1 Antibody Picoband®, Carrier-free
A15336-1-carrier-free 100 µg/Vial

Anti-RSBN1 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details