DYRK2 Peptide - middle region
DYRK2 Peptide - middle region
Product Specifications
UniProt
Q92630
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DYRK2 Rabbit Polyclonal Antibody (orb588256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003574.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGS
More Discoveries
Explore Other Products
Browse additional items from our catalog
C9100-21L-APC 100 µL
Cytomegalovirus Glycoprotein B, Late Cytoplasmic Antigen (CMV gB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (APC)
Sign In for Pricing
View Details 