Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Peptide - middle region

DYRK2 Peptide - middle region

Product Specifications

UniProt

Q92630

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYRK2 Rabbit Polyclonal Antibody (orb588256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003574.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGS

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKP1 Antibody
OACA03673-100UG 100 µg

SKP1 Antibody

Sign In for Pricing
View Details
Spink3 Protein Vector (Mouse) (pPM-C-His)
PV233405 500 ng

Spink3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Bovine Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y, PIGY GENLISA ELISA
KLB2003 96 Well

Bovine Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y, PIGY GENLISA ELISA

Sign In for Pricing
View Details
Rat Annexin A6,ANXA6 ELISA KIT
JOT-EK1126Ra 96 wells

Rat Annexin A6,ANXA6 ELISA KIT

Sign In for Pricing
View Details
MUTYH Rabbit pAb
A1612-01 20 µL

MUTYH Rabbit pAb

Sign In for Pricing
View Details
MUTYH Rabbit pAb
A1612-02 100 μL

MUTYH Rabbit pAb

Sign In for Pricing
View Details