WNT5B Peptide - middle region
WNT5B Peptide - middle region
Product Specifications
UniProt
Q9H1J7
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WNT5B Rabbit Polyclonal Antibody (orb588873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_110402.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
829023 1 Card (1 Panel (s) x 1 Pack)
STNL W018-148x210-PP-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)
Sign In for Pricing
View Details MBS1403023 Inquire
Recombinant Listeria monocytogenes serovar 1/2a Formate--tetrahydrofolate ligase (fhs), partial
Sign In for Pricing
View Details 
GTR15079832 1 Vial
Lentiviral human FOXE3 shRNA (UAS) - Lentiviral human FOXE3 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details