Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT5B Peptide - middle region

WNT5B Peptide - middle region

Product Specifications

UniProt

Q9H1J7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WNT5B Rabbit Polyclonal Antibody (orb588873) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110402.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REPS2 Human shRNA Plasmid Kit (Locus ID 9185)
TR309870 1 Kit

REPS2 Human shRNA Plasmid Kit (Locus ID 9185)

Sign In for Pricing
View Details
Safety Goggles, Curved
2110280/7 1 Each

Safety Goggles, Curved

Sign In for Pricing
View Details
IFI-16 Polyclonal Antibody
JOT-AP04346-01 20 µL

IFI-16 Polyclonal Antibody

Sign In for Pricing
View Details
IFI-16 Polyclonal Antibody
JOT-AP04346-02 50 μL

IFI-16 Polyclonal Antibody

Sign In for Pricing
View Details
IFI-16 Polyclonal Antibody
JOT-AP04346-03 100 µL

IFI-16 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-STAT5a Antibody Picoband® Fluoro488 Conjugated
PA1840-Fluoro488 100 µg/Vial

Anti-STAT5a Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details