Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TICAM1 Peptide - C-terminal region

TICAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TRIF, IIAE6, MyD88-3, PRVTIRB, TICAM-1

UniProt

Q8IUC6

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TICAM1 Rabbit Polyclonal Antibody (orb588939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_891549.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REG3A Antibody
PT-A04718-01 2 µg

REG3A Antibody

Sign In for Pricing
View Details
REG3A Antibody
PT-A04718-02 10 µg

REG3A Antibody

Sign In for Pricing
View Details
REG3A Antibody
PT-A04718-03 0.1 mg

REG3A Antibody

Sign In for Pricing
View Details
Anti-CAPE antibody
STJ70224 100 µg

Anti-CAPE antibody

Sign In for Pricing
View Details
Human Interleukin 3 Receptor Alpha, Active Protein
RPU60436-01 50 µg

Human Interleukin 3 Receptor Alpha, Active Protein

Sign In for Pricing
View Details
Human Interleukin 3 Receptor Alpha, Active Protein
RPU60436-02 100 µg

Human Interleukin 3 Receptor Alpha, Active Protein

Sign In for Pricing
View Details