Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A10 Peptide - N-terminal region

SLC5A10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SGLT5, SGLT-5

UniProt

A0PJK1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC5A10 Rabbit Polyclonal Antibody (orb588975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035915.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPX6 siRNA
abx902300-01 15 nmol

Human GPX6 siRNA

Sign In for Pricing
View Details
Human GPX6 siRNA
abx902300-02 30 nmol

Human GPX6 siRNA

Sign In for Pricing
View Details
Lentiviral mouse C1qtnf12 shRNA (UAS) - Lentiviral mouse C1qtnf12 shRNA (UAS) (25)
GTR15143021 1 Vial

Lentiviral mouse C1qtnf12 shRNA (UAS) - Lentiviral mouse C1qtnf12 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii tam Protein (aa 1-254)
VAng-Yyj5143-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii tam Protein (aa 1-254)

Sign In for Pricing
View Details
Mouse Monoclonal FARSB Antibody (OTI4B3) [Janelia Fluor 549]
NBP2-71539JF549 0.1 mL

Mouse Monoclonal FARSB Antibody (OTI4B3) [Janelia Fluor 549]

Sign In for Pricing
View Details
LXR beta Antibody
E38QA5280 100 µL

LXR beta Antibody

Sign In for Pricing
View Details