Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAPIN Peptide - middle region

SNAPIN Peptide - middle region

Product Specifications

Product Name Alternative

BLOS7, SNAPAP, BLOC1S7

UniProt

O95295

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNAPIN Rabbit Polyclonal Antibody (orb588977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)
MBS1475404-01 0.05 mg (E-Coli)

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)

Sign In for Pricing
View Details
Recombinant Cucumber mosaic virus Capsid protein (ORF3b)
MBS1475404-02 0.05 mg (Yeast)

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)

Sign In for Pricing
View Details
Recombinant Cucumber mosaic virus Capsid protein (ORF3b)
MBS1475404-03 0.2 mg (E-Coli)

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)

Sign In for Pricing
View Details
Recombinant Cucumber mosaic virus Capsid protein (ORF3b)
MBS1475404-04 0.05 mg (Baculovirus)

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)

Sign In for Pricing
View Details
Recombinant Cucumber mosaic virus Capsid protein (ORF3b)
MBS1475404-05 0.5 mg (E-Coli)

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)

Sign In for Pricing
View Details
Recombinant Cucumber mosaic virus Capsid protein (ORF3b)
MBS1475404-06 0.2 mg (Yeast)

Recombinant Cucumber mosaic virus Capsid protein (ORF3b)

Sign In for Pricing
View Details