Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAPIN Peptide - middle region

SNAPIN Peptide - middle region

Product Specifications

Product Name Alternative

BLOS7, SNAPAP, BLOC1S7

UniProt

O95295

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNAPIN Rabbit Polyclonal Antibody (orb588977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 7, CT (Caspase-7, CASP 7, CASP7, CASP-7, Apoptosis-related Cysteine Peptidase, Apoptosis Related Cysteine Protease, Apoptotic Protease MCH3, CMH 1, CMH-1, ICE-like Apoptotic Protease 3, ICE LAP3, ICE-LAP3, MCH3) (FITC)
C2087-29K-FITC 100 µL

Caspase 7, CT (Caspase-7, CASP 7, CASP7, CASP-7, Apoptosis-related Cysteine Peptidase, Apoptosis Related Cysteine Protease, Apoptotic Protease MCH3, CMH 1, CMH-1, ICE-like Apoptotic Protease 3, ICE LAP3, ICE-LAP3, MCH3) (FITC)

Sign In for Pricing
View Details
Disodium 4-sulfinatobenzoate
SAA62481-01 50 mg

Disodium 4-sulfinatobenzoate

Sign In for Pricing
View Details
Disodium 4-sulfinatobenzoate
SAA62481-02 0.5 g

Disodium 4-sulfinatobenzoate

Sign In for Pricing
View Details
Cdc7 Rabbit Polyclonal Antibody (Cy5)
orb895848 100 µL

Cdc7 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Anti-TRAM1L1 Antibody Picoband® (Dylight488 Conjugate)
A18207-1-Dylight488 100 µg

Anti-TRAM1L1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Recombinant Coronavirus 2019 Membrane Envelope
MBS141688-01 0.05 mg

Recombinant Coronavirus 2019 Membrane Envelope

Sign In for Pricing
View Details