RIN1 Peptide - N-terminal region
RIN1 Peptide - N-terminal region
Product Specifications
UniProt
Q13671
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RIN1 Rabbit Polyclonal Antibody (orb588986) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004283.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLTRPVWLQLQANAAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6375126-01 0.1 mL
CUGBP2 (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like Family Member 2, Bruno-like Protein 3, CUG Triplet Repeat RNA-binding Protein 2, CUG-BP-and ETR-3-like Factor 2, ELAV-type RNA-binding Protein 3, Neuroblastoma Apoptosis-related RNA-binding Prot
Sign In for Pricing
View Details MBS6375126-02 5x 0.1 mL
CUGBP2 (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like Family Member 2, Bruno-like Protein 3, CUG Triplet Repeat RNA-binding Protein 2, CUG-BP-and ETR-3-like Factor 2, ELAV-type RNA-binding Protein 3, Neuroblastoma Apoptosis-related RNA-binding Prot
Sign In for Pricing
View Details 
EK245440 96 Well
Pig HMGB-1 (HighMobility Group Protein B1) ELISA Kit
Sign In for Pricing
View Details IH-8053-15 Each Reagent 15 mL
Immuno HRP-DAB, Anti-Chicken IgY (H+L)
Sign In for Pricing
View Details