Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIN1 Peptide - N-terminal region

RIN1 Peptide - N-terminal region

Product Specifications

UniProt

Q13671

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIN1 Rabbit Polyclonal Antibody (orb588986) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004283.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLTRPVWLQLQANAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tie-1 Antibody, Mouse Monoclonal
MBS8103039-01 0.02 mL

Anti-Tie-1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-Tie-1 Antibody, Mouse Monoclonal
MBS8103039-02 0.1 mL

Anti-Tie-1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-Tie-1 Antibody, Mouse Monoclonal
MBS8103039-03 5x 0.1 mL

Anti-Tie-1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
IBDV-VP2 Mouse mAb
orb3184631-01 50 µL

IBDV-VP2 Mouse mAb

Sign In for Pricing
View Details
IBDV-VP2 Mouse mAb
orb3184631-02 100 µL

IBDV-VP2 Mouse mAb

Sign In for Pricing
View Details
IBDV-VP2 Mouse mAb
orb3184631-03 200 µL

IBDV-VP2 Mouse mAb

Sign In for Pricing
View Details