Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A3 Peptide - middle region

ALDH1A3 Peptide - middle region

Product Specifications

Product Name Alternative

ALDH6, MCOP8, RALDH3, ALDH1A6

UniProt

P47895

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1A3 Rabbit Polyclonal Antibody (orb588997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000684.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAM2 Antibody
MBS8513242-01 0.05 mg

STAM2 Antibody

Sign In for Pricing
View Details
STAM2 Antibody
MBS8513242-02 0.1 mg

STAM2 Antibody

Sign In for Pricing
View Details
STAM2 Antibody
MBS8513242-03 0.1 mL (AF750)

STAM2 Antibody

Sign In for Pricing
View Details
STAM2 Antibody
MBS8513242-04 0.1 mL (AF405M)

STAM2 Antibody

Sign In for Pricing
View Details
STAM2 Antibody
MBS8513242-05 0.1 mL (AF546)

STAM2 Antibody

Sign In for Pricing
View Details
STAM2 Antibody
MBS8513242-06 0.1 mL (AF405L)

STAM2 Antibody

Sign In for Pricing
View Details