CETN2 Peptide - middle region
CETN2 Peptide - middle region
Product Specifications
Product Name Alternative
CALT, CEN2
UniProt
P41208
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CETN2 Rabbit Polyclonal Antibody (orb589003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004335.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7261676-01 48 Well
Canine Caspase Activated Deoxyribonuclease, CAD ELISA Kit
Sign In for Pricing
View Details MBS7261676-02 96 Well
Canine Caspase Activated Deoxyribonuclease, CAD ELISA Kit
Sign In for Pricing
View Details MBS7261676-03 5x 96 Well
Canine Caspase Activated Deoxyribonuclease, CAD ELISA Kit
Sign In for Pricing
View Details MBS7261676-04 10x 96 Well
Canine Caspase Activated Deoxyribonuclease, CAD ELISA Kit
Sign In for Pricing
View Details MBS1044978-01 0.02 mg (E-Coli)
Recombinant Yersinia pestis Glutamyl-tRNA reductase (hemA)
Sign In for Pricing
View Details