Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM67 Peptide - C-terminal region

TMEM67 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MKS3, JBTS6, NPHP11, TNEM67, MECKELIN

UniProt

Q5HYA8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM67 Rabbit Polyclonal Antibody (orb589008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135773.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQKNLASKTLVDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Goat Polyclonal Antibody to Human IgG,
BAT-2100-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Human IgG,

Sign In for Pricing
View Details
GJB6 (NM_001110219) Human Over-expression Lysate
LC426316 20 µg

GJB6 (NM_001110219) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713739 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-,  5nm
GP-5001-5 1 mL

Colloidal Gold Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-, 5nm

Sign In for Pricing
View Details
Mouse Nmi activation kit by CRISPRa
GA206488 1 Kit

Mouse Nmi activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details