AEN Peptide - N-terminal region
AEN Peptide - N-terminal region
Product Specifications
Product Name Alternative
ISG20L1, pp12744
UniProt
Q8WTP8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AEN Rabbit Polyclonal Antibody (orb589013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073604.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGAATA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041985-100 1x 100 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TA372975 100 µL
Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![Centrin 1 (CETN1) Mouse Monoclonal Antibody [Clone ID: OTI4G6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907dbd/imageurl/cf804239.webp)
CF804239 100 µg
Centrin 1 (CETN1) Mouse Monoclonal Antibody [Clone ID: OTI4G6]
Sign In for Pricing
View Details 