AEN Peptide - N-terminal region
AEN Peptide - N-terminal region
Product Specifications
Product Name Alternative
ISG20L1, pp12744
UniProt
Q8WTP8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AEN Rabbit Polyclonal Antibody (orb589013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073604.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGAATA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041574-500 1x 500 µL
HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740808-100 1x 100 µL
TRP1 (Tyrosinase Related Protein 1) (TA99 + TYRP1/807), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP322718L 1 mg
MAD1 (MAD1L1) (NM_001013836) Human Recombinant Protein
Sign In for Pricing
View Details 
10-2005-100 100 µg
Recombinant Anti-SARS-CoV-2 Spike RBD antibody (ABMX-002)
Sign In for Pricing
View Details 