GYG1 Peptide - middle region
GYG1 Peptide - middle region
Product Specifications
Product Name Alternative
GYG, GSD15
UniProt
P46976
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GYG1 Rabbit Polyclonal Antibody (orb589041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001171649.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6248267-01 0.1 mL
RANKL (Receptor Activator of Nuclear Factor kappa B Ligand, Receptor Activator of NFkB Ligand, CD254, hRANKL2, hRANKL-2, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, sOdf, SOFA, TNF-related Activation-induced Cytokine, TRANCE, Tum
Sign In for Pricing
View Details MBS6248267-02 5x 0.1 mL
RANKL (Receptor Activator of Nuclear Factor kappa B Ligand, Receptor Activator of NFkB Ligand, CD254, hRANKL2, hRANKL-2, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, sOdf, SOFA, TNF-related Activation-induced Cytokine, TRANCE, Tum
Sign In for Pricing
View Details orb2568412-01 48 Tests
Human CD38 (ADP-ribosyl cyclase 1) Quick ELISA Kit
Sign In for Pricing
View Details orb2568412-02 96 Tests
Human CD38 (ADP-ribosyl cyclase 1) Quick ELISA Kit
Sign In for Pricing
View Details 