Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYG1 Peptide - middle region

GYG1 Peptide - middle region

Product Specifications

Product Name Alternative

GYG, GSD15

UniProt

P46976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYG1 Rabbit Polyclonal Antibody (orb589041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4B Antibody - middle region
OAAB10283-400UL 400 µL

C4B Antibody - middle region

Sign In for Pricing
View Details
CASP10 Antibody
orb107451 100 µL

CASP10 Antibody

Sign In for Pricing
View Details
C4orf32 Protein Vector (Human) (pPB-His-MBP)
PV331170 500 ng

C4orf32 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Human NFATC1 shRNA Plasmid
abx953165-01 150 µg

Human NFATC1 shRNA Plasmid

Sign In for Pricing
View Details
Human NFATC1 shRNA Plasmid
abx953165-02 300 µg

Human NFATC1 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBL039W-B Polyclonal Antibody
MBS7150617 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBL039W-B Polyclonal Antibody

Sign In for Pricing
View Details