Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBN1 Peptide - middle region

DBN1 Peptide - middle region

Product Specifications

Product Name Alternative

D0S117E

UniProt

Q16643

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBN1 Rabbit Polyclonal Antibody (orb589097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004386.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)
orb2933646-01 20 µg

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)

Sign In for Pricing
View Details
Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)
orb2933646-02 100 µg

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)

Sign In for Pricing
View Details
MPP1 CytoSection
TS401754P5 25 Slides

MPP1 CytoSection

Sign In for Pricing
View Details
Mouse Casp14/Caspase-14 ELISA Kit
EK19949 Inquire

Mouse Casp14/Caspase-14 ELISA Kit

Sign In for Pricing
View Details
Anti-Alpha enolase
Y123146 100 µL

Anti-Alpha enolase

Sign In for Pricing
View Details
SCMH1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA808436S 30 µL

SCMH1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]

Sign In for Pricing
View Details