Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBN1 Peptide - middle region

DBN1 Peptide - middle region

Product Specifications

Product Name Alternative

D0S117E

UniProt

Q16643

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBN1 Rabbit Polyclonal Antibody (orb589097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004386.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9430007A20Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10888154 3x 1.0 µg DNA

9430007A20Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
F-L-E-E-V (AA: Phe-Leu-Glu-Glu-Val) (MW: 635.72)
SP-88513-5 5 mg

F-L-E-E-V (AA: Phe-Leu-Glu-Glu-Val) (MW: 635.72)

Sign In for Pricing
View Details
Foretinib 50mg
A10998-50 50 mg

Foretinib 50mg

Sign In for Pricing
View Details
NSBP1 Rabbit Polyclonal Antibody (APC)
orb995361 100 µL

NSBP1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
AF-6 Antibody
C50578-01 40 µL

AF-6 Antibody

Sign In for Pricing
View Details
AF-6 Antibody
C50578-02 100 µL

AF-6 Antibody

Sign In for Pricing
View Details