Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2B4 Peptide - middle region

EIF2B4 Peptide - middle region

Product Specifications

Product Name Alternative

EIF2B, EIF-2B, EIF2Bdelta

UniProt

Q9UI10

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2B4 Rabbit Polyclonal Antibody (orb589099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001029288.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKKPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMV

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAM1-set siRNA/shRNA/RNAi Lentivector (Human)
45192091 4x 500 ng

SPAM1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
2- (Naphthalen-2-yl) propan-2-amine
OR86734-01 100 mg

2- (Naphthalen-2-yl) propan-2-amine

Sign In for Pricing
View Details
2- (Naphthalen-2-yl) propan-2-amine
OR86734-02 250 mg

2- (Naphthalen-2-yl) propan-2-amine

Sign In for Pricing
View Details
2- (Naphthalen-2-yl) propan-2-amine
OR86734-03 1 g

2- (Naphthalen-2-yl) propan-2-amine

Sign In for Pricing
View Details
Quick Step Human activated coagulation factor XII, aFXIIa ELISA Kit
QS0050Hu-01 48 Tests

Quick Step Human activated coagulation factor XII, aFXIIa ELISA Kit

Sign In for Pricing
View Details
Quick Step Human activated coagulation factor XII, aFXIIa ELISA Kit
QS0050Hu-02 96 Tests

Quick Step Human activated coagulation factor XII, aFXIIa ELISA Kit

Sign In for Pricing
View Details