EIF2B4 Peptide - middle region
EIF2B4 Peptide - middle region
Product Specifications
Product Name Alternative
EIF2B, EIF-2B, EIF2Bdelta
UniProt
Q9UI10
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF2B4 Rabbit Polyclonal Antibody (orb589099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001029288.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VKKPERQQVPTRKDYGSKVSLFSHLPQYSRQNSLTQFMSIPSSVIHPAMV
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7233207-01 48 Well
Mouse Alpha-tocopherol transfer protein-like (TTPAL) ELISA Kit
Sign In for Pricing
View Details 
MBS7233207-02 96 Well
Mouse Alpha-tocopherol transfer protein-like (TTPAL) ELISA Kit
Sign In for Pricing
View Details MBS7233207-03 5x 96 Well
Mouse Alpha-tocopherol transfer protein-like (TTPAL) ELISA Kit
Sign In for Pricing
View Details MBS7233207-04 10x 96 Well
Mouse Alpha-tocopherol transfer protein-like (TTPAL) ELISA Kit
Sign In for Pricing
View Details