WBP1 Peptide - middle region
WBP1 Peptide - middle region
Product Specifications
Product Name Alternative
WBP-1
UniProt
A8MX15
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WBP1 Rabbit Polyclonal Antibody (orb589100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036609.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
297976-01 250 mg
2'-Deoxy-5'-O-DMT-N6-isobutyryladenosine 3'-CE phosphoramidite
Sign In for Pricing
View Details 297976-02 500 mg
2'-Deoxy-5'-O-DMT-N6-isobutyryladenosine 3'-CE phosphoramidite
Sign In for Pricing
View Details 297976-03 1 g
2'-Deoxy-5'-O-DMT-N6-isobutyryladenosine 3'-CE phosphoramidite
Sign In for Pricing
View Details