Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WBP1 Peptide - middle region

WBP1 Peptide - middle region

Product Specifications

Product Name Alternative

WBP-1

UniProt

A8MX15

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WBP1 Rabbit Polyclonal Antibody (orb589100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036609.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Prostasin/Prss8 Antibody
NBP1-57037 100 µL

Rabbit Polyclonal Prostasin/Prss8 Antibody

Sign In for Pricing
View Details
CKMT2 Polyclonal Antibody
MBS2529585-01 0.02 mL

CKMT2 Polyclonal Antibody

Sign In for Pricing
View Details
CKMT2 Polyclonal Antibody
MBS2529585-02 0.06 mL

CKMT2 Polyclonal Antibody

Sign In for Pricing
View Details
CKMT2 Polyclonal Antibody
MBS2529585-03 0.12 mL

CKMT2 Polyclonal Antibody

Sign In for Pricing
View Details
CKMT2 Polyclonal Antibody
MBS2529585-04 0.2 mL

CKMT2 Polyclonal Antibody

Sign In for Pricing
View Details
CKMT2 Polyclonal Antibody
MBS2529585-05 5x 0.2 mL

CKMT2 Polyclonal Antibody

Sign In for Pricing
View Details