GLIPR2 Peptide - middle region
GLIPR2 Peptide - middle region
Product Specifications
Product Name Alternative
GAPR1, GAPR-1, C9orf19
UniProt
Q9H4G4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLIPR2 Rabbit Polyclonal Antibody (orb589102) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071738.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
102500U0-AAT 100 Tests
MFluor™ Green 620 Anti-human CD25 Antibody *HI25a*
Sign In for Pricing
View Details 
47347154 3x 1.0 µg DNA
Tpbpb CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details