Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCLRE1A Peptide - N-terminal region

DCLRE1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSO2, SNM1, SNM1A

UniProt

Q6PJP8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCLRE1A Rabbit Polyclonal Antibody (orb589104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258745.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOSC1 Antibody, FITC conjugated
A72379-50UG 50 µg

EXOSC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
IQCG Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9022R-PerCP-Cy5.5 100 µL

IQCG Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
NANOG Antibody (N-term) Blocking Peptide
MBS9221184-01 0.5 mg

NANOG Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
NANOG Antibody (N-term) Blocking Peptide
MBS9221184-02 5x 0.5 mg

NANOG Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
UMUC3 SMAD/TGFbeta Reporter (Luc) stable cell line
GTR15424185 1 Vial

UMUC3 SMAD/TGFbeta Reporter (Luc) stable cell line

Sign In for Pricing
View Details
CLDN1 Polyclonal Antibody, FITC Conjugated
bs-0790R-FITC 100 µL

CLDN1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details