Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEZ6L2 Peptide - middle region

SEZ6L2 Peptide - middle region

Product Specifications

Product Name Alternative

BSRPA, PSK-1

UniProt

X5D9C2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEZ6L2 Rabbit Polyclonal Antibody (orb589105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GHRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RECQL Antibody Picoband® Fluoro594 Conjugated
A02415-Fluoro594 100 µg/Vial

Anti-RECQL Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Presenilin 1
P6300-36D 100 µL

Presenilin 1

Sign In for Pricing
View Details
KRT33B, NT (KRT33B, HHA3-II, HKA3B, KRTHA3B, Keratin, type I cuticular Ha3-II, Hair keratin, type I Ha3-II, Keratin-33B) (PE) discontinued
037617-PE 200 µL

KRT33B, NT (KRT33B, HHA3-II, HKA3B, KRTHA3B, Keratin, type I cuticular Ha3-II, Hair keratin, type I Ha3-II, Keratin-33B) (PE) discontinued

Sign In for Pricing
View Details
SLC41A2 3'UTR GFP Stable Cell Line
TU073628 1.0 mL

SLC41A2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Goat vitamin D (VD) ELISA Kit
YP-W75651-01 48 Tests

Goat vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details
Goat vitamin D (VD) ELISA Kit
YP-W75651-02 96 Tests

Goat vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details