Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEZ6L2 Peptide - middle region

SEZ6L2 Peptide - middle region

Product Specifications

Product Name Alternative

BSRPA, PSK-1

UniProt

X5D9C2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEZ6L2 Rabbit Polyclonal Antibody (orb589105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GHRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCLRE1C Peptide - N-terminal region
MBS3235182-01 0.1 mg

DCLRE1C Peptide - N-terminal region

Sign In for Pricing
View Details
DCLRE1C Peptide - N-terminal region
MBS3235182-02 5x 0.1 mg

DCLRE1C Peptide - N-terminal region

Sign In for Pricing
View Details
POSE2-TA-Luc
D4243-1μg 1 μg

POSE2-TA-Luc

Sign In for Pricing
View Details
RPL5P19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1876806 1.0 µg DNA

RPL5P19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CDV3 Antibody - N-terminal region : HRP (ARP66531_P050-HRP)
ARP66531_P050-HRP 100 µL

CDV3 Antibody - N-terminal region : HRP (ARP66531_P050-HRP)

Sign In for Pricing
View Details
Lentiviral mouse Cxcr3 shRNA (UAS) - Lentiviral mouse Cxcr3 shRNA (UAS) (100)
GTR15175398 1 Vial

Lentiviral mouse Cxcr3 shRNA (UAS) - Lentiviral mouse Cxcr3 shRNA (UAS) (100)

Sign In for Pricing
View Details