Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A13 Peptide - middle region

SLC39A13 Peptide - middle region

Product Specifications

Product Name Alternative

LZT-Hs9

UniProt

G3V1B2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A13 Rabbit Polyclonal Antibody (orb589108) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121697.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Ethyl-2-oxopyrrolidine-3-carboxylic acid
VKC54829-01 50 mg

3-Ethyl-2-oxopyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
3-Ethyl-2-oxopyrrolidine-3-carboxylic acid
VKC54829-02 0.5 g

3-Ethyl-2-oxopyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
6-Hydroxy oxymorphone discontinued
279169-01 1 mg

6-Hydroxy oxymorphone discontinued

Sign In for Pricing
View Details
6-Hydroxy oxymorphone discontinued
279169-02 2 mg

6-Hydroxy oxymorphone discontinued

Sign In for Pricing
View Details
6-Hydroxy oxymorphone discontinued
279169-03 5 mg

6-Hydroxy oxymorphone discontinued

Sign In for Pricing
View Details
6-Hydroxy oxymorphone discontinued
279169-04 10 mg

6-Hydroxy oxymorphone discontinued

Sign In for Pricing
View Details