Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHD1 Peptide - N-terminal region

EFHD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SWS2, MST133, PP3051, MSTP133

UniProt

A0A024R493

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFHD1 Rabbit Polyclonal Antibody (orb589109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230181.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Didymin
BA2819-5 5 mg

Didymin

Sign In for Pricing
View Details
Horse Neuroprotectin D1 (NPD1) ELISA Kit
MBS9393325-01 48 Well

Horse Neuroprotectin D1 (NPD1) ELISA Kit

Sign In for Pricing
View Details
Horse Neuroprotectin D1 (NPD1) ELISA Kit
MBS9393325-02 96 Well

Horse Neuroprotectin D1 (NPD1) ELISA Kit

Sign In for Pricing
View Details
Horse Neuroprotectin D1 (NPD1) ELISA Kit
MBS9393325-03 5x 96 Well

Horse Neuroprotectin D1 (NPD1) ELISA Kit

Sign In for Pricing
View Details
Horse Neuroprotectin D1 (NPD1) ELISA Kit
MBS9393325-04 10x 96 Well

Horse Neuroprotectin D1 (NPD1) ELISA Kit

Sign In for Pricing
View Details
PPP2CA Antibody, FITC conjugated
CSB-PA018559LC01HU-01 50 µg

PPP2CA Antibody, FITC conjugated

Sign In for Pricing
View Details