Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHD1 Peptide - N-terminal region

EFHD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SWS2, MST133, PP3051, MSTP133

UniProt

A0A024R493

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFHD1 Rabbit Polyclonal Antibody (orb589109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230181.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Asp-OAll
sc-228156 5 g

Fmoc-Asp-OAll

Sign In for Pricing
View Details
SPACA5B CRISPR All-in-one AAV vector set (with saCas9)(Human)
45175151 3x 1.0 µg DNA

SPACA5B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
2-Methylimidazole
KI-0036-HP-0500 500 g

2-Methylimidazole

Sign In for Pricing
View Details
3-[5- (2-Chlorophenyl) -1,2,4-oxadiazol-3-yl]aniline
423568-01 100 mg

3-[5- (2-Chlorophenyl) -1,2,4-oxadiazol-3-yl]aniline

Sign In for Pricing
View Details
3-[5- (2-Chlorophenyl) -1,2,4-oxadiazol-3-yl]aniline
423568-02 250 mg

3-[5- (2-Chlorophenyl) -1,2,4-oxadiazol-3-yl]aniline

Sign In for Pricing
View Details
2- (N'-Acetylhydrazino) -5-chloro-3-fluoropyridine
sc-305932A 1 g

2- (N'-Acetylhydrazino) -5-chloro-3-fluoropyridine

Sign In for Pricing
View Details