Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP4 Peptide - C-terminal region

RAB11FIP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB11-FIP4

UniProt

Q86YS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP4 Rabbit Polyclonal Antibody (orb589120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001290471.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dok5 ORF Vector (Mouse) (pORF)
18510015 1.0 µg DNA

Dok5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
BSA Antibody HRP Conjugated
orb1543702 100 µL

BSA Antibody HRP Conjugated

Sign In for Pricing
View Details
M-Tyramine hydrobromide
orb1709202-01 5 mg

M-Tyramine hydrobromide

Sign In for Pricing
View Details
M-Tyramine hydrobromide
orb1709202-02 1 ml x 10 mM (in DMSO)

M-Tyramine hydrobromide

Sign In for Pricing
View Details
ASCL1 Polyclonal Antibody
BT-AP00664-01 20 µL

ASCL1 Polyclonal Antibody

Sign In for Pricing
View Details
ASCL1 Polyclonal Antibody
BT-AP00664-02 50 µL

ASCL1 Polyclonal Antibody

Sign In for Pricing
View Details