Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP4 Peptide - C-terminal region

RAB11FIP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB11-FIP4

UniProt

Q86YS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP4 Rabbit Polyclonal Antibody (orb589120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001290471.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELLS (Helicase, Lymphoid-Specific, FLJ10339, LSH, Nbla10143, PASG, SMARCA6) (APC)
246996-APC 100 µL

HELLS (Helicase, Lymphoid-Specific, FLJ10339, LSH, Nbla10143, PASG, SMARCA6) (APC)

Sign In for Pricing
View Details
Lentiviral human LRRC46 shRNA (UAS) - Lentiviral human LRRC46 shRNA (UAS, RFP) plasmid
GTR15325264 1 Vial

Lentiviral human LRRC46 shRNA (UAS) - Lentiviral human LRRC46 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Goat galanin prepropeptide (GAL) ELISA Kit
MBS7208812-01 48 Well

Goat galanin prepropeptide (GAL) ELISA Kit

Sign In for Pricing
View Details
Goat galanin prepropeptide (GAL) ELISA Kit
MBS7208812-02 96 Well

Goat galanin prepropeptide (GAL) ELISA Kit

Sign In for Pricing
View Details
Goat galanin prepropeptide (GAL) ELISA Kit
MBS7208812-03 5x 96 Well

Goat galanin prepropeptide (GAL) ELISA Kit

Sign In for Pricing
View Details
Goat galanin prepropeptide (GAL) ELISA Kit
MBS7208812-04 10x 96 Well

Goat galanin prepropeptide (GAL) ELISA Kit

Sign In for Pricing
View Details