ZNF346 Peptide - middle region
ZNF346 Peptide - middle region
Product Specifications
Product Name Alternative
JAZ, Zfp346
UniProt
Q9UL40
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF346 Rabbit Polyclonal Antibody (orb589131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001295142.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1357804 1.0 µg DNA
MTA2 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 126393 50 µg
EPHX1 (Epoxide Hydrolase 1, Epoxide Hydratase, Microsomal Epoxide Hydrolase, EPHX, EPOX)
Sign In for Pricing
View Details C4587 96 Tests
Coiled-coil domain-containing protein 105 (CCDC105) Bovine ELISA Kit
Sign In for Pricing
View Details