ABHD11 Peptide - middle region
ABHD11 Peptide - middle region
Product Specifications
Product Name Alternative
PP1226, WBSCR21
UniProt
Q8NFV4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ABHD11 Rabbit Polyclonal Antibody (orb589139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138836.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7037699-01 0.02 mg
Recombinant Geobacillus thermodenitrificans UPF0756 membrane protein GTNG_2661 (GTNG_2661)
Sign In for Pricing
View Details MBS7037699-02 0.1 mg
Recombinant Geobacillus thermodenitrificans UPF0756 membrane protein GTNG_2661 (GTNG_2661)
Sign In for Pricing
View Details