Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCB Peptide - C-terminal region

CALCB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALC2, CGRP2, CGRP-II

UniProt

P10092

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALCB Rabbit Polyclonal Antibody (orb573671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000719

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin Recombinant Rabbit Monoclonal Antibody [ST46-03]
ET1609-21 100 µL

Ubiquitin Recombinant Rabbit Monoclonal Antibody [ST46-03]

Sign In for Pricing
View Details
PLEKHD1 Human Over-expression Lysate
orb1359811 20 µg

PLEKHD1 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype II Small delta antigen
MBS1432722-01 0.02 mg (E-Coli)

Recombinant Hepatitis delta virus genotype II Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype II Small delta antigen
MBS1432722-02 0.1 mg (E-Coli)

Recombinant Hepatitis delta virus genotype II Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype II Small delta antigen
MBS1432722-03 0.02 mg (Yeast)

Recombinant Hepatitis delta virus genotype II Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype II Small delta antigen
MBS1432722-04 0.1 mg (Yeast)

Recombinant Hepatitis delta virus genotype II Small delta antigen

Sign In for Pricing
View Details