Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCB Peptide - C-terminal region

CALCB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALC2, CGRP2, CGRP-II

UniProt

P10092

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALCB Rabbit Polyclonal Antibody (orb573671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000719

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody
MBS9438245-01 0.1 mL (AF350)

KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody
MBS9438245-02 0.1 mL (AF405)

KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody
MBS9438245-03 0.1 mL (AF488)

KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody
MBS9438245-04 0.1 mL (AF555)

KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody
MBS9438245-05 0.1 mL (Biotin)

KLF5 (Phospho-Ser303) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
BET1 Protein Vector (Human) (pPB-N-His)
PV004018 500 ng

BET1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details