Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTO1 Peptide - middle region

GSTO1 Peptide - middle region

Product Specifications

Product Name Alternative

P28, SPG-R, GSTO 1-1, GSTTLp28, HEL-S-21

UniProt

P78417

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTO1 Rabbit Polyclonal Antibody (orb610930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004823

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S301 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV744587 1.0 µg DNA

RN5S301 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-CD8a Antibody [OKT8], APC-500Tests
QAB17-APC-500Tests 500Tests

Anti-CD8a Antibody [OKT8], APC-500Tests

Sign In for Pricing
View Details
1-Phenyl-3-piperidin-1-yl-propylamine
sc-303781 500 mg

1-Phenyl-3-piperidin-1-yl-propylamine

Sign In for Pricing
View Details
Anti-Human CLL-1
IT-300-058M3-01 0.1 mg

Anti-Human CLL-1

Sign In for Pricing
View Details
Anti-Human CLL-1
IT-300-058M3-02 0.5 mg

Anti-Human CLL-1

Sign In for Pricing
View Details
BAX Antibody
orb2683677-01 50 µL

BAX Antibody

Sign In for Pricing
View Details