Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTO1 Peptide - middle region

GSTO1 Peptide - middle region

Product Specifications

Product Name Alternative

P28, SPG-R, GSTO 1-1, GSTTLp28, HEL-S-21

UniProt

P78417

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTO1 Rabbit Polyclonal Antibody (orb610930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004823

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc9b1 AAV siRNA Pooled Vector
44311166 1.0 µg

Slc9b1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ELOVL6 Rabbit Polyclonal Antibody (BF555)
orb2395364 100 µL

ELOVL6 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
THEMIS Recombinant Antibody, PE-Cy5 Conjugated
bsm-62442R-PE-Cy5-TR 20 µL

THEMIS Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Plant Zinc Finger Protein 510 (ZNF510) ELISA Kit
MBS9371778 Inquire

Plant Zinc Finger Protein 510 (ZNF510) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PBEF/Visfatin/NAMPT Antibody [Alexa Fluor 350]
NB100-594AF350 100 µL

Rabbit Polyclonal PBEF/Visfatin/NAMPT Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Rat Ankyrin B, Ank-B ELISA Kit
MBS7254816-01 48 Well

Rat Ankyrin B, Ank-B ELISA Kit

Sign In for Pricing
View Details