Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN5 Peptide - middle region

CAPN5 Peptide - middle region

Product Specifications

Product Name Alternative

VRNI, ADNIV, HTRA3, nCL-3

UniProt

O15484

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN5 Rabbit Polyclonal Antibody (orb589068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004046.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM151B Protein Vector (Rat) (pPM-C-His)
PV311417 500 ng

TMEM151B Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Cyclin A Double Nickase Plasmid (h2)
sc-400119-NIC-2 20 µg

Cyclin A Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Brs3 ORF Vector (Rat) (pORF)
ORF064156 1.0 µg DNA

Brs3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
POMT1 (NM_001077366) Human Over-expression Lysate
LS010585 100 µg

POMT1 (NM_001077366) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Annexin V
Y058249 100 µL

Anti-Annexin V

Sign In for Pricing
View Details
CXCR7 / RDC1 Immunizing Peptide
MBS428726-01 0.1 mg

CXCR7 / RDC1 Immunizing Peptide

Sign In for Pricing
View Details