Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN5 Peptide - middle region

CAPN5 Peptide - middle region

Product Specifications

Product Name Alternative

VRNI, ADNIV, HTRA3, nCL-3

UniProt

O15484

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN5 Rabbit Polyclonal Antibody (orb589068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004046.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Molecular Sieves 4AX1.5 MM
175605000 5 Kg

Molecular Sieves 4AX1.5 MM

Sign In for Pricing
View Details
CACNG1 AAV Vector (Mouse) (CMV)
14899104 1 µg

CACNG1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Inhibin beta A Rabbit mAb Antibody
orb3015279 100 µL

Inhibin beta A Rabbit mAb Antibody

Sign In for Pricing
View Details
Human RITA1 Pre-designed siRNA Set A
SI013790A 1 Each

Human RITA1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
P4HA3 (prolyl 4-hydroxylase, alpha Polypeptide III) (PE)
MBS6187395-01 0.1 mL

P4HA3 (prolyl 4-hydroxylase, alpha Polypeptide III) (PE)

Sign In for Pricing
View Details
P4HA3 (prolyl 4-hydroxylase, alpha Polypeptide III) (PE)
MBS6187395-02 5x 0.1 mL

P4HA3 (prolyl 4-hydroxylase, alpha Polypeptide III) (PE)

Sign In for Pricing
View Details