Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYCL Peptide - middle region

MYCL Peptide - middle region

Product Specifications

Product Name Alternative

LMYC, L-Myc, MYCL1, bHLHe38

UniProt

P12524

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYCL Rabbit Polyclonal Antibody (orb589148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028253.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mfsd5 ORF Vector (Rat) (pORF)
ORF070518 1.0 µg DNA

Mfsd5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
rno-miR-154-3p miRNA Antagomir
MNR01162 2x 5.0 nmol

rno-miR-154-3p miRNA Antagomir

Sign In for Pricing
View Details
NCOA6 polyclonal antibody
BS77382-01 50 µL

NCOA6 polyclonal antibody

Sign In for Pricing
View Details
NCOA6 polyclonal antibody
BS77382-02 100 µL

NCOA6 polyclonal antibody

Sign In for Pricing
View Details
Anti-SARS-CoV-2 RBD antibody (2A93)
RVV00318 100 μg

Anti-SARS-CoV-2 RBD antibody (2A93)

Sign In for Pricing
View Details
IER5L siRNA (Rat)
orb1827332-01 15 nmol

IER5L siRNA (Rat)

Sign In for Pricing
View Details