Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PJA1 Peptide - middle region

PJA1 Peptide - middle region

Product Specifications

Product Name Alternative

RNF70, PRAJA1

UniProt

Q8NG27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PJA1 Rabbit Polyclonal Antibody (orb589155) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001027568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Histone H2A.X (Thr120) Antibody
A10905-50UG 50 µg

Phospho-Histone H2A.X (Thr120) Antibody

Sign In for Pricing
View Details
Goat Substance P (SP) ELISA Kit
MBS261002-01 48 Well

Goat Substance P (SP) ELISA Kit

Sign In for Pricing
View Details
Goat Substance P (SP) ELISA Kit
MBS261002-02 96 Well

Goat Substance P (SP) ELISA Kit

Sign In for Pricing
View Details
Goat Substance P (SP) ELISA Kit
MBS261002-03 5x 96 Well

Goat Substance P (SP) ELISA Kit

Sign In for Pricing
View Details
Goat Substance P (SP) ELISA Kit
MBS261002-04 10x 96 Well

Goat Substance P (SP) ELISA Kit

Sign In for Pricing
View Details
Bovine coronavirus (strain 98TXSF-110-LUN) Non-structural Protein 2a (His)
TMPH-00235-01 5 µg

Bovine coronavirus (strain 98TXSF-110-LUN) Non-structural Protein 2a (His)

Sign In for Pricing
View Details