Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PJA1 Peptide - middle region

PJA1 Peptide - middle region

Product Specifications

Product Name Alternative

RNF70, PRAJA1

UniProt

Q8NG27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PJA1 Rabbit Polyclonal Antibody (orb589155) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001027568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL15A1 Recombinant Protein Antigen
NBP1-91088PEP 0.1 mL

COL15A1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Anti-Rat EAAC1/EAAT3 IgG #1, aff pure
EAAC11-A 100 µg

Anti-Rat EAAC1/EAAT3 IgG #1, aff pure

Sign In for Pricing
View Details
NUP160 Rabbit Polyclonal Antibody
orb629474-01 50 µg

NUP160 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUP160 Rabbit Polyclonal Antibody
orb629474-02 100 µg

NUP160 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF85 Rabbit Polyclonal Antibody (BF488)
orb2418119 100 µL

ZNF85 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human IL1RL1 (Interleukin 1 receptor like 1) for Antibody Discovery
MP0068Q Each

Magic™ Membrane Protein Human IL1RL1 (Interleukin 1 receptor like 1) for Antibody Discovery

Sign In for Pricing
View Details