Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBA3D Peptide - N-terminal region

TUBA3D Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2-ALPHA

UniProt

Q13748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBA3D Rabbit Polyclonal Antibody (orb589156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005992.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE5A (NM_001083) Human Over-expression Lysate
LY421205 100 µg

PDE5A (NM_001083) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565640 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
Pdcd1 Mouse Gene Knockout Kit (CRISPR)
KN312990RB 1 Kit

Pdcd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 20 Rabbit Polyclonal Antibody
ER1901-76 100 µL

Cytokeratin 20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Adamantanamine Sulfate
TRC-A576010-250MG 250 mg

1-Adamantanamine Sulfate

Sign In for Pricing
View Details
CD1b (RIV12), CF594 conjugate, 0.1mg/mL
BNC940317-100 1x 100 µL

CD1b (RIV12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details