Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBA3D Peptide - N-terminal region

TUBA3D Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2-ALPHA

UniProt

Q13748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBA3D Rabbit Polyclonal Antibody (orb589156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005992.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS800081 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
MK6-83
TRC-M424600-5MG 5 mg

MK6-83

Sign In for Pricing
View Details
Mouse Entpd1 activation kit by CRISPRa
GA200617 1 Kit

Mouse Entpd1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565561 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
CARD8 (NM_001184900) Human Over-expression Lysate
LC433245 20 µg

CARD8 (NM_001184900) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene AM RAM
H12516023.5G 5 g

Polystyrene AM RAM

Sign In for Pricing
View Details