Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSTD2 Peptide - N-terminal region

TSTD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf97

UniProt

Q5T7W7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSTD2 Rabbit Polyclonal Antibody (orb55776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640339.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALFVKTKEVPTKRSFE

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPEG4-NH2
abx186255-01 1 g

MPEG4-NH2

Sign In for Pricing
View Details
MPEG4-NH2
abx186255-02 5 g

MPEG4-NH2

Sign In for Pricing
View Details
Scn4b (NM_001013390) Mouse Recombinant Protein
PM42662M5 20 µg

Scn4b (NM_001013390) Mouse Recombinant Protein

Sign In for Pricing
View Details
CD14 (Monocyte Differentiation Antigen CD14) (MaxLight 490)
MBS6410112-01 0.1 mL

CD14 (Monocyte Differentiation Antigen CD14) (MaxLight 490)

Sign In for Pricing
View Details
CD14 (Monocyte Differentiation Antigen CD14) (MaxLight 490)
MBS6410112-02 5x 0.1 mL

CD14 (Monocyte Differentiation Antigen CD14) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Diacylglycerol Kinase Alpha (DGKa)(Sandwich ELISA) ELISA Kit
MBS2125266-01 24 Strip Well

Mouse Diacylglycerol Kinase Alpha (DGKa)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details